PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798752.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 475aa    MW: 51572.7 Da    PI: 8.2426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798752.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10327385563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK+ +i eLe kv++L++e ++L  ++  l+k   +l s +
  XP_009798752.1 327 KRAKRILANRQSAARSKERKLRYISELEYKVQKLQTEATTLSTQVTILQKDFTELSSLN 385
                     9***********************************************99999998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-15323387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.036325388IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-11327384No hitNo description
SuperFamilySSF579594.29E-11327380No hitNo description
PfamPF001702.5E-9327385IPR004827Basic-leucine zipper domain
CDDcd147031.84E-20328379No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MAQSNSKPPM SHNFGVGASH VRSLSQPSIF LNNCLPPLSP LPPSESSIVS ANTSLKDTSM  60
EEVDVNCQVP KAVSNFVREN ALRGSDGLPP RKGHRRSNSD VSLGFSDMIQ SSPQLIPISG  120
QRISGRAVNL GDSSGREKTI DLQKQPMGLS SNGRIDVEGI GERKSRGEVT DELLFSYMNL  180
ENIEALNSSG TEDRDKGSMV SGAKVSGNES SNNEAESLLK GNGVSSQLTS LREGVKRSAD  240
ADIAPTTRHF RSLSMDSAIG GFHYGDESPK LPASLVNHSG QLSPSNSGNE SSSQRNFDFG  300
NAEFSEAEMK KIMADEKLAE IAVSDPKRAK RILANRQSAA RSKERKLRYI SELEYKVQKL  360
QTEATTLSTQ VTILQKDFTE LSSLNSELKF RVQAMEQQAQ LRDALHEALT SEVQRLKLAA  420
GELREEGRLP NSMIQQMPVK HNMFPMQRQQ PSQIQQLSVG KPTTASSASA TPASA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798752.10.0PREDICTED: uncharacterized protein LOC104244929
RefseqXP_009798753.10.0PREDICTED: uncharacterized protein LOC104244929
RefseqXP_009798754.10.0PREDICTED: uncharacterized protein LOC104244929
TrEMBLM0ZWF90.0M0ZWF9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095380.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-96bZIP family protein